PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_33_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 318aa    MW: 36111.2 Da    PI: 4.9801
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_33_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.7e-151461148
                                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                       +g+WT+eEd++l+  +   G  +W+++++  g+ R++k+c++rw +yl
  cra_locus_33_iso_2_len_1424_ver_3 14 KGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                                       79******************************99************97 PP

2Myb_DNA-binding51.22.9e-1671111547
                                        -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                    Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                        ++ E++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
  cra_locus_33_iso_2_len_1424_ver_3  71 SEYEEKMVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                                        6779**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-20563IPR009057Homeodomain-like
PROSITE profilePS5129413.533961IPR017930Myb domain
SuperFamilySSF466891.02E-2611108IPR009057Homeodomain-like
SMARTSM007173.3E-121363IPR001005SANT/Myb domain
PfamPF002492.9E-141461IPR001005SANT/Myb domain
CDDcd001678.14E-91661No hitNo description
PROSITE profilePS5129425.60962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2464117IPR009057Homeodomain-like
SMARTSM007173.8E-1466114IPR001005SANT/Myb domain
PfamPF002494.7E-1471111IPR001005SANT/Myb domain
CDDcd001675.22E-1174112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDKKLISFIL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEYEEKMVID LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPVTHKPLN DGSPPPREQA EPPKNHQEPP PHSNSTTNSS HEMDQNSITT DDQDIALSPF  180
IDSNNNINIM DDEEVNNGFC IDEVPLIQPH EILVPPETTT SSASSSLISP TTSSSSSSSS  240
CSNYSYDSRN LVNNEELMPT TFDWQNDFMM TTNINMGNIW EDIDDDFITN LDYLINNDGN  300
LDFHHRNNIV DVEDSWKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616533.11e-108PREDICTED: protein ODORANT1-like
TrEMBLA0A068U0161e-106A0A068U016_COFCA; Uncharacterized protein
STRINGPOPTR_0017s02850.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154